SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781774|ref|YP_003372529.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781774|ref|YP_003372529.1|
Domain Number 1 Region: 425-577
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-45
Family GGDEF domain 0.0000976
Further Details:      
 
Domain Number 2 Region: 61-238
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.9e-29
Family MioX-like 0.09
Further Details:      
 
Domain Number 3 Region: 289-402
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000384
Family Heme-binding PAS domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283781774|ref|YP_003372529.1|
Sequence length 779
Comment diguanylate cyclase and metal dependent phosphohydrolase [Pirellula staleyi DSM 6068]
Sequence
MEPTLPDSRHATSETSRQNTLEQADANLATVSSLLSTLTSEVDVAQDSADLAFENRLVQV
RLGLASGLFGALRARHAPTAAHCLRVALGCSAWSASLSLAEEQRDSIEVGALLHDVGKIG
IPDHILLKPGKLSPEEYLTVEQHRRVGLGILSHCCASGDVLAIVQHSGAWFDGSRDGYNL
SGDDLPMGARMVSIVDAFDAMTTDQIYRRAMSRERALAELFEFAGTQFDPQLVQDFCAYI
SSESASLPGAVARRWLKQLSPENSNEFWRLEYRAPAAPSTNTCDAVFQHKLLESMHDAVI
FVDNNLQIVHWNRAAERLTGIAASSIEHKKWSPSLVSLRDEKERLIDDPECPVIQAIKNG
VQTVRRLSVTGRNGQRVDIDAHLVPVHGKNGLMHGAAVLLHDASSRITLEQRVQTLHEKA
TRDPLTQVANRAEFDEIHATYVQSHRDRRLPFSLIICDIDYFKRINDNFGHQAGDEVLQS
FAALLRRHTRPGDLVARYGGEEFVLLCIDCDNTAATRRAEELRRELAEFPMAALGNKSIT
ASFGVTELQNGDTPETMLRRADRALYQAKESGRNTVIQLGSGIDGEEPAPRATGWLSWLR
GTTPDQLLSRTLVTSVPLNVVVEKMRGFMADHHAEIVSIAESHLTLRIDGENTPFLRRNS
DRPVPFFIEMKFSEATVPAEGRGNPTSRTIVHVTIRPHRSRDRRRRDAIERAGQLLLSLK
SYLVAQEVRGPSDLTVIPNTKVAPTTAETPSPTTTEVEVVAKLAQDAPKARSFFSWGSK
Download sequence
Identical sequences D2R258
WP_012912928.1.69553 gi|283781774|ref|YP_003372529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]