SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283781851|ref|YP_003372606.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781851|ref|YP_003372606.1|
Domain Number 1 Region: 8-185
Classification Level Classification E-value
Superfamily CheY-like 1.85e-40
Family CheY-related 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283781851|ref|YP_003372606.1|
Sequence length 235
Comment winged helix family two component transcriptional regulator [Pirellula staleyi DSM 6068]
Sequence
METMVRFMHDPLVLIIEDEAPIRKMLRASLTSEGYRIQEASSAAEGLKIATSPPPDLILL
DLGLPDRDGQEVLEQLREWYTSPIIILSARDQESQKIKALDHGADDYVTKPFSMGELLAR
MRTALRHSHRTGTEATATTIGDLKVDFASRLVYRKQEEVHLTPLEYKLLITMIKHAGKVL
THRFLLREVWGPQDSQENHYLRVFVAGLRRKIEVDPARPQYILTEQGVGYRFRGE
Download sequence
Identical sequences D2R313
gi|283781851|ref|YP_003372606.1| WP_012913005.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]