SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781852|ref|YP_003372607.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781852|ref|YP_003372607.1|
Domain Number 1 Region: 727-891
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-40
Family Histidine kinase 0.0035
Further Details:      
 
Domain Number 2 Region: 666-738
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000143
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 258-383
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000000661
Family Universal stress protein-like 0.015
Further Details:      
 
Domain Number 4 Region: 599-652
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000632
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781852|ref|YP_003372607.1|
Sequence length 909
Comment osmosensitive K channel His kinase sensor [Pirellula staleyi DSM 6068]
Sequence
MTDSRPNPDALLALAEDEQKLDDTTTGKRGSLRIFFGYAAGVGKTYGMLEAAQAARREGR
DVVVGYIEPHARKETQALAADFETLPTKQLSYRGVTLREFDVDAALARKAEITLVDELAH
TNAEGSRHEKRWQDIEELCASGLHVWTTLNVQHLESLNDVIGQITGVQVRETIPDHVFDA
ADQLELIDITPEELLGRLEAGKIYLPEQAKRAIQSFFQRSNLSALRELSLRQAARRVHTD
VESARRARSVRQPWATTDRLLVCVGPSPTTARVIRTAKRMASALDAPWIAVSVDLTGASS
TSPASQQIAEHFRLAERLGAETVTLPGQRMTETILEYARTRNVTKILIGKTDQPRWKRLL
MGTVVDEILEQSGEIDVYVIHGEKDQAARVATPPARPPIDYWLYGKAAVPVGLAGLAALA
MKRWHFADAEANTVMIFLAAVAWAAFRFGRGPAIVASLLAVTIFDFFFVPPFHTFAVADT
QYIVTFAVMLAIALLISTLTSRLRAQLEAMRDRQRRTAALYELGKQLSSLYGSSFLAKAA
GEKIAEMVGGEVAIYLDRHAPSPELVFGARSSIALQHGSSAVAHWVIQHGQMAGAGTSTL
PSAVGLFLPLIGSQRVHGAMAVAVASAARLQQPELRQLLESCASQLAISIERDALVVEAA
DARVKAEAEQVRSSLLSSVSHDLKTPLAAIAGASSTLLEASSLPPSTREQLLQTVAEEAV
RLGRLLENILQMSKLDAGASPPHLEWHMLEEIVGSSIRRIEKSLTQHQLIIQIPEQLPLL
RLDGLLMEQVFVNLLENAARYTTAGSTISVRAVVEGQEVRVTVADNGPGLPAGAEEKVFD
KFYRAFPSADGGRGSGLGLAICRAIVKVHGGRIEAANLPAGGAEFVIHLPLAQDIPQVPL
SPSDSSRAS
Download sequence
Identical sequences D2R314
WP_012913006.1.69553 gi|283781852|ref|YP_003372607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]