SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781894|ref|YP_003372649.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781894|ref|YP_003372649.1|
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily Cobalamin adenosyltransferase-like 1.61e-62
Family Cobalamin adenosyltransferase 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781894|ref|YP_003372649.1|
Sequence length 182
Comment ATP/cobalamin adenosyltransferase [Pirellula staleyi DSM 6068]
Sequence
MKIYTRTGDEGETGLFGGPRVRKDNARIEAYGTVDELNAFLGLARCETLPPLIEHVLEQV
QADLFSVGAELATPEPQKLNMPLVGDADVTQLELAIDALEEPLQPLRNFILPGGTKAAAT
LHVARGVCRRAERWVVHLGAAEQVEISPWIIRYLNRLSDYLFVAARYANYSASVADVPWQ
HR
Download sequence
Identical sequences D2R356
WP_012913048.1.69553 gi|283781894|ref|YP_003372649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]