SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782042|ref|YP_003372797.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782042|ref|YP_003372797.1|
Domain Number 1 Region: 341-505
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-35
Family Histidine kinase 0.0025
Further Details:      
 
Domain Number 2 Region: 6-167
Classification Level Classification E-value
Superfamily CheY-like 5.69e-22
Family CheY-related 0.0022
Further Details:      
 
Domain Number 3 Region: 131-258
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.68e-21
Family Flavin-binding PAS domain 0.029
Further Details:      
 
Domain Number 4 Region: 279-347
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000143
Family Homodimeric domain of signal transducing histidine kinase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283782042|ref|YP_003372797.1|
Sequence length 523
Comment multi-sensor signal transduction histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MNQVSIEILLLEDEPAHVALVRRAFSGESDPYELVVCSTLAEARHYLQSHVPSAAIVDMG
LPDGRGTDLLTEGDQAARFPTIILTSQGSERAAVESIKAGALDYITKSPTSLLDMPQLVR
RVMREWQLMADREQARRALADEEQRFRQMAEHIRDVFWMYDLVNRKVLYVSPAFEAIWGR
PPSFLSEPPEVVLTAAHMEDRARVRLEPNEWTSTTVHDQVFRIVRPDGAIRWIHDRRFPI
TDPDGQIRRIVGVAEDVTDRQEASDKLQQQFVEMCHVARLSTMGELVAGIAHEVNQPLYA
IANYSAAASDALRAGGELPIEQMRQWNDDISKAVTRAADVIKRIRAYVSKGPSQRVPTNI
STLVEESIELVAIEARRSKVQVHLNVSRPSPILEVDPVAIQQVMCNVLLNAYEAMQSLPA
ESRVARVATYVEPRYVRIEISDNGPGLTPQVEQQLFVPFFTTKPSGMGMGLAISKTIVDA
HGGDISARSNDRGTTIVVRLPLADADSARAAERQDHELAAWHM
Download sequence
Identical sequences D2R4X5
WP_012913196.1.69553 gi|283782042|ref|YP_003372797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]