SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782044|ref|YP_003372799.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782044|ref|YP_003372799.1|
Domain Number 1 Region: 671-833
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-33
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 358-468
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.29e-19
Family Heme-binding PAS domain 0.064
Further Details:      
 
Domain Number 3 Region: 455-587
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000471
Family PYP-like 0.057
Further Details:      
 
Domain Number 4 Region: 601-679
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Domain Number 5 Region: 64-205
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000371
Family GAF domain 0.021
Further Details:      
 
Domain Number 6 Region: 197-323
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000489
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283782044|ref|YP_003372799.1|
Sequence length 840
Comment multi-sensor signal transduction histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MIEGGETNAMTTSHPSPLSAAQEIAQLKARIADLESSAAAHQCTTAEQLLAAAALGMTSS
TGREFFDKLTTHLALTLKMDYVVVGVLLPGRDRVATLSMHGPEGLEKMVEYDLGGTPCEN
VVSQDVCVYPANVTRYFPTDQMLIDMGIESYLGIPLRGSKQEVLGLLAVLSRKTLGDISM
VRQVLEIFSSRASAEVERLKVEQQLSSERSHLLMAMQAGRVATYEWDLLTQQLTWSEGVN
EIFGIEDDLSLGNLMQMGSNIHPEDLPRLKQYVSELRAGVLIGGLEFRLRQSGEYRWLRL
QGRIAYDEQQRPRRIVGTMSDVTLDHQVQQQQFTFRQRVQRLIETQQLILDGMPIGCLMN
DADMRITYANPAVETIFGYSSEELVGELPFGKLVPERSRDGVLQVLAQLRSGVRNTLGID
EHLTKEGRTVFCEWRHTPLFSLSGDFVGYLSMVLDVTERVRRDEQIRRNEQLLRRQLDEL
EGIYAAAPVGLAFFDRHGRLVRMNDLLSQAFGSRADRLIGRSLEEILGESAGPMVTPLER
VITTGQSVSDVCVVTRSGLGAKEQRHWLVDYCPVLGIAGEVVGVTAVVEEVTSRVLAERE
RENLIRQLEMKNAELERFAYTVSHDLKSPLITISGFAGVLEQDLDMGQMQAARDDLREIK
DAATHMSLLLDELLQLSRVGRFVGELRPIVLGNVVRRVLSAAAGRLGSKYVEFVVDPHLP
TVMGDEVRLYELFQNLVDNAIKFSGMAAVPRITFSCRSLAPTIVMEVRDNGIGVQPRYLE
KIFGLFEQLSPEVEGTGVGLAIAKRVMEVHGGKIWAESEGLGKGTAIVMEFPACDSSSDS
Download sequence
Identical sequences D2R4X7
gi|283782044|ref|YP_003372799.1| WP_012913198.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]