SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782097|ref|YP_003372852.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|283782097|ref|YP_003372852.1|
Domain Number - Region: 137-206
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0628
Family MgtE N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283782097|ref|YP_003372852.1|
Sequence length 233
Comment hypothetical protein Psta_4345 [Pirellula staleyi DSM 6068]
Sequence
MKPLSLLGSLFAAFCIGTVVSLFVLAGVLWSKGFLTGDRMTAAMAAFYGIQPKTTAETST
SATDVTEQPALDDLSSKRVLASLDLDLRENAIDKSLGDLRALQTQIKTERERLDQWKMSF
DQRLATLETATTDSALAEVQRTLESMQPKQAKEQILKMLEASPRGANDKPMRDIVTIIKA
LPLDRRKKILLEFKTPDEAEKLAEILREIRLGTPDIDVIRDSRNQLQQTPSNR
Download sequence
Identical sequences D2R530
WP_012913251.1.69553 gi|283782097|ref|YP_003372852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]