SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782276|ref|YP_003373031.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782276|ref|YP_003373031.1|
Domain Number 1 Region: 328-502
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-47
Family Histidine kinase 0.00075
Further Details:      
 
Domain Number 2 Region: 535-654
Classification Level Classification E-value
Superfamily CheY-like 5.27e-38
Family CheY-related 0.0032
Further Details:      
 
Domain Number 3 Region: 20-99
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.27e-22
Family FHA domain 0.002
Further Details:      
 
Domain Number 4 Region: 128-248
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.25e-22
Family Heme-binding PAS domain 0.011
Further Details:      
 
Domain Number 5 Region: 255-340
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.51e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283782276|ref|YP_003373031.1|
Sequence length 675
Comment PAS/PAC sensor hybrid histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MNTAASSLQVWYLHSIGEASSIARQVTITPLPFRVGRSSDAQLWIPSSSVSKIHAEFFER
DGQLYLRDLGSTNGTFVNAERIRGDVAVQSGDIVHFSTLGFQIDCWAGNLLGNTIEENPF
QTALAAEIDERRRAEELLWNSQARWRAVFDNAADGIITLNESLQVETYNTAAQRLFGYSC
EQIVGLQISLLMPGVELDSSNAAAPQAGRRIETLCRRSDGSMFLADVSLGTVPQSKSHGY
IAIIRDITRQRRDQQELEEAKRAAESASHAKDEFLANMSHEIRTPITAILGFSDLLIHDQ
RLQNEFPNWFESAQTVYRNGEHLLSLINDVLDLSKIEAGRLLIESIRCSPLEIVRDVCQL
MSLKASEKDLTLDVSFRTDIPVTAVTDPTRIKQVLINLVGNAVKFTPRGSVQITVDIHSS
GHATMLAVEVTDTGIGMTSAQIDRLFQPFTQADASTTRRFGGTGLGLVISKRIVEALGGQ
VSVVSQSGEGSTFRVLLPLIVPTESAWLTPSEALTALREPLPRPQISAGPQLTGRILVAD
DGIDNQRLLRQILTRAGADVTVAENGLEAVRAWQAANLAGCPFALILMDMQMPELDGYQA
TRRLRELGATIPIIALTAHAMTGDRDLCLQAGCDDYLTKPFERKRLLETLRKRLLETPLL
SIDPHHDGTLRTNAP
Download sequence
Identical sequences D2R6W8
WP_012913430.1.69553 gi|283782276|ref|YP_003373031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]