SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782285|ref|YP_003373040.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782285|ref|YP_003373040.1|
Domain Number 1 Region: 641-797
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.29e-40
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 423-551
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 129-298
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-23
Family GAF domain 0.0098
Further Details:      
 
Domain Number 4 Region: 332-435
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-18
Family Heme-binding PAS domain 0.021
Further Details:      
 
Domain Number 5 Region: 59-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000548
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.02
Further Details:      
 
Domain Number 6 Region: 567-643
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000184
Family Homodimeric domain of signal transducing histidine kinase 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283782285|ref|YP_003373040.1|
Sequence length 805
Comment multi-sensor signal transduction histidine kinase [Pirellula staleyi DSM 6068]
Sequence
MAISYFERPTSQRLLEMLRHTLDSTGSFLTLVSLHEGTCEIVGRPDWLRPIVDHPAYRTS
WRQLVHNDDAEKLYEAWSSLLAGNSENYSVDYRFCDRWGEYRWLREQVAVVSTDQHGRPV
EMVVLHREFTPTVQRDKMLDAHDEIVTKMTEGMPLMAMLSKLAETIEAHFPGSRVSVMML
DAQREHLGIVAAPSMPPELVTTFSNIPVGPEFGACGAAAYLKQRVIVHDVREDSRTIPYL
PILEPYDLRAIWSHPILDGSQEVIGTFALYRSRPFTPDAEEIRLTEMAARLAGLAIERHS
QAELLVRREDRFRRLAESSRIVPWEADGVSDVYLYVGPQAEKIWGYPQADFLKPRFWIDH
LVHPDDREMCEELCSKIIAPQELYEWDYRTVGADGRTIWVHDVVNVNWRGSRLAQMFGYL
IDITDRKQAEEQLRESEERYRLLAEQSADMISRVDPSGIWRYVSCACTSVLGYDPSELVG
TYTMDVVHVDDRREAAELLMAIDRWPDVPNFTCRARHKHGHYVLLETMGKPIYDAHTGRL
AEIIFFSRDITSREEQSLRVRAREAELAHAERLSTMGQLAAELAHELNQPLYALANYAQA
AQGLVAGWEVPNKQMLLDWTAQMMQQARRASEVVRRITSFVRQGELDRQPVNLNECVEEI
GMLMEISARQRGIDLVYELGESLPLVKVDRLLIEQVILNLVRNGLEATEPSEGGAAKLTV
ETSTTAQAVRLRVIDQGRGIPNDKLSCLFEPYFTTKPDGTGIGLAICRRAIESHGGVIWG
ENNPGGGATFAFELPHASPAAGESA
Download sequence
Identical sequences D2R6X7
WP_012913439.1.69553 gi|283782285|ref|YP_003373040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]