SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782457|ref|YP_003373212.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782457|ref|YP_003373212.1|
Domain Number 1 Region: 14-205,313-395
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.44e-53
Family Bacterial dinuclear zinc exopeptidases 0.003
Further Details:      
 
Domain Number 2 Region: 196-296
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.53e-17
Family Bacterial exopeptidase dimerisation domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283782457|ref|YP_003373212.1|
Sequence length 397
Comment peptidase dimerization domain-containing protein [Pirellula staleyi DSM 6068]
Sequence
MLQSPATTTPEPDLSRATKLVVELMAIPGKSGEELTVAEFVKAKLLAAGASADTIRTDNA
NQKSVLKGNVGNLIMKLPGTVKGPRRMLTSHMDTVPLCVGCEPVIEGKIVKSANPSTALG
ADNRGGVAATLVAAIELLEKKLPHPPLTFCWFIQEEIGLHGARHLQQSLLGKPAMCFNWD
GGAPDKLTVGATSGYRMDIKVHGIASHAGVAPEKGVSAIAIAAMAIADLARGGWHGLIKK
GKFSGTSNVGVISGGDATNVVTDEVHVRAEARSHSPKFREKIIKEITKAFQKAAKELKSS
EGRRGSVEIEGRLDYETFRLDPEHACVKLAEKACLEVGRSPIRAISNGGLDANWLNAHGI
PTVTLGCGQVNVHTVKEQLDLPGFHDACRIALKLATV
Download sequence
Identical sequences D2R821
WP_012913611.1.69553 gi|283782457|ref|YP_003373212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]