SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283779519|ref|YP_003370274.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283779519|ref|YP_003370274.1|
Domain Number 1 Region: 4-73
Classification Level Classification E-value
Superfamily Homeodomain-like 5.49e-19
Family Tetracyclin repressor-like, N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 79-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.04e-16
Family Tetracyclin repressor-like, C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283779519|ref|YP_003370274.1|
Sequence length 209
Comment TetR family transcriptional regulator [Pirellula staleyi DSM 6068]
Sequence
MGRVSDTREKLLASALRLVWQRGYAAVTIEEICDAAGVRKGSFYHFFPTKEAVVTAALEE
DFASFRAELDRIFSCTTAPLTRLTHFFQHITRQQMALHKTTGQLLGCPIGSISCEVIPQE
KKLSTCIQTIFATYEHYLAAAIRDAIAAGELPKQNIARQARLLTALFEGILAQARIHNDP
GLLKSLLPAVMNLLGAPQKVKRRKVGKPE
Download sequence
Identical sequences D2QYV9
gi|283779519|ref|YP_003370274.1| WP_012910677.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]