SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283780471|ref|YP_003371226.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283780471|ref|YP_003371226.1|
Domain Number 1 Region: 1078-1289
Classification Level Classification E-value
Superfamily NHL repeat 4.97e-18
Family NHL repeat 0.014
Further Details:      
 
Domain Number 2 Region: 485-757
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.16e-16
Family Quinoprotein alcohol dehydrogenase-like 0.0046
Further Details:      
 
Domain Number 3 Region: 923-1028
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000587
Family PBS lyase HEAT-like repeat 0.043
Further Details:      
 
Domain Number 4 Region: 79-114,178-244
Classification Level Classification E-value
Superfamily TPR-like 0.000026
Family Tetratricopeptide repeat (TPR) 0.079
Further Details:      
 
Weak hits

Sequence:  gi|283780471|ref|YP_003371226.1|
Domain Number - Region: 789-867
Classification Level Classification E-value
Superfamily HCP-like 0.0562
Family HCP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283780471|ref|YP_003371226.1|
Sequence length 1314
Comment Pyrrolo-quinoline quinone [Pirellula staleyi DSM 6068]
Sequence
MNKSILPYWSSTRAVVFALVGSFLFTSTLSAQLAPIPLPGAFGIKRAVAGPAKAEDDSAP
DPSETRFPGGAALKTDPEQQRLLKRADQCVADGRLDLAVVLWQKVLDEAGDTLMTRDGRT
YTSLADEIELTLASLPPLALSTYRITADGEAQAILSRATPETEEDALARVANRYFLSSLG
DDAAFRLACLALDRHDFVGASRLLNKILERHPDPSVPRAEVLLRLAVASSRVGDKQGAET
SLSSIASVAGPRPERSILDAVTEQLAATSSSFSSEFSLDWPMLLGSSSRSGAMRPLPSAA
SERTLTELWVQEVELSASDSNVMNPWGGMVAPGIMVRRSAVRDPNAQPQVFSREQLVSQW
RQNGWLPTGQLLFRDNKVYIKLADELICFHTSALNSQPVWRSVWLNQFELDGMSQMLMMM
QMNMGIQTQASQRPKSAAEVMLFGDRIHQSMSLVDDMIYSIEGKRLGRDETPPRVARQQR
GFQWGVTPRRTRTNFLAAYEADSGKVKWHRGASDEDKEGSQDVGFLAAPVGSGELLLAPV
TDGGTIWLYAMAKSDGSTRWKTYLCDEPQGGAAPWSPTIMAVDGRDAYLTCGNGVVFAID
AVGGNIRWAVRYERDGKPDDRMRQMYGTQYGAMMSFEGWTEDVVIPSGRTLVVLSSDSDK
IVALDRRSGQIIWESPRVKWEVPATYVLGVSGRGLFVAGKNVVRRYDIPSGRLVWVTELE
DSLGRGTLTSDAIYMPVNDSIVKLDLEKGTKQTQVGVSLTTDDPVGNLYSDGEKFWVTGG
GRVYAMTNLDHRLNMLAEQIKAGDADAQFNRMRLYSKQKDLDRTLADLRGGYQLVLAKST
PDEAAARLFAAIAELKLSQQNPDVTIDLMNEMFVAPTERPTISKEMAMKRGSLLVNTLFV
VRQKKLVGQTERILKLAPILDQEHLITAAAQTLTALPPTADDLPAIRVALEAKEAAGPIM
AAGILAKLAPDEAKQSLPKLLGDTDENVQLAAARALMNLGDRAALTKLGELLDALSSKVR
TRSYQSLRAATGQTLPFIAEAKPEEREKAVAAWKEWISTTGATAELKLPLPDVDMPLGRT
LLVSQAQGLIIELDADHKERWRKQVPNPWSCQGLPNGHRLVTLFAQNTVVEYDEEGKEVW
KKDRLPGPVYSCQRLENGGTLVACADVQQIIEIAPDGTQTTITVQGRPMSARRLSNGNTL
VALQQGGRVVEVDSTGKTVWEARNMNGPCHVERLENGNTIVCQMYTGQVVEVDPSGQKTV
WTAKVPLVNPFCAQRLPNGNTLIADNNGVSEVDPTGTQVKWQQRMGNITGVSQY
Download sequence
Identical sequences D2R6R6
gi|283780471|ref|YP_003371226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]