SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283781091|ref|YP_003371846.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283781091|ref|YP_003371846.1|
Domain Number 1 Region: 287-386,419-628
Classification Level Classification E-value
Superfamily NHL repeat 1.33e-33
Family NHL repeat 0.0076
Further Details:      
 
Domain Number 2 Region: 128-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.26e-28
Family Glutathione peroxidase-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283781091|ref|YP_003371846.1|
Sequence length 782
Comment NHL repeat containing protein [Pirellula staleyi DSM 6068]
Sequence
MMAREFWLRFSALSVAGLMALTGCAGQPASTTPIPTAALATEAPAEKPSESTDVNSAESA
PASENSEPDSPAPAESPASSPAEPASESQPTEAPAEEAKEPAPEVAAEDAPKAEEPEIAH
PFPRRFDLPDFPKDMEWINTGALSKRDIKGKFVLLDFWTYCCINCMHVLPELKKLEKKYP
NELVVIGVHSAKFDTEKDAANIRSAVLRYEVEHPVVNDAEHEIWNMCGVSSWPTVLLVDP
EGFAVWGRAGEFKFEEVQAVIERAKPYYIAKKLLDEKPIKFPLESEKEAPTPLRFPGKIL
ADAAGQRLFISDSNHNRIVITSLDGKLIETIGSGVIGKADGSFAEASFDHPQGCALDGET
LYVADTENHLLRKIDLTKKTVTTIAGTGKQAESAWPGIEEVRLTAEVPERWVGPPKTTGI
NSPWALWVHEKNLYIAMAGPHQIWKMPLDESEIGPYAGNGREDIVDGPLIPKVPYTEGFS
SFAQPSGLSSDGEWLFVADSEGSSIRAVPFDPTKEVRTIVGTSELPGGRLFDFGDVDGPR
ERAKLQHALEVVYSEGKIYVADTYNNKIKLVDAKTGEVKTIAGSGSPGTSDDPATFDEPA
GLALVGETLYVADTNNHLIRKVDVATGKTSTLTIEGLTPPQKPVAAKTPDFSSAKVEKLE
TVTLKPVDGKVTLQVKLVLPEGWKTNPLAPMSYYVDLAGESGPVSRAAAGKKKLAAPTST
FAVELPVTSDGTDEVTISLNYYYCEKSDEGVCKIGSVVFKVPLKLDAAAESASAELSHAA
AE
Download sequence
Identical sequences D2QXE6
WP_012912248.1.69553 gi|283781091|ref|YP_003371846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]