SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283782412|ref|YP_003373167.1| from Pirellula staleyi DSM 6068

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782412|ref|YP_003373167.1|
Domain Number 1 Region: 11-287
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.8e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000894
Further Details:      
 
Domain Number 2 Region: 289-420
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.05e-25
Family Anticodon-binding domain of Class II aaRS 0.00018
Further Details:      
 
Domain Number 3 Region: 437-503
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.0000000001
Family C-terminal domain of ProRS 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283782412|ref|YP_003373167.1|
Sequence length 503
Comment prolyl-tRNA synthetase [Pirellula staleyi DSM 6068]
Sequence
MAKTAISPTREEDYPEWYQQVIRAADLAEVSPVRGCMVIKPWGWSIWENVQKVLDGMFKA
TGHENAYFPLFIPMSFLEKEAEHVDGFAKECAVVTHHRLEPGKDGKLVPAGPLEEPLIVR
PTSETIIGSMYAKWVQSYRDLPILINQWANVVRWELRTRLFLRTTEFLWQEGHTAHATEE
EAREETSKMLEVYADFAENFMAMPVIKGEKTAGERFPGAVQTLSIEAMMQDRKALQAGTS
HFLGQNFAKAQEIKFQDQHGKECFAWTTSWGVSTRLIGALIMTHSDDDGLIIPPKLAPKH
IVLLPIYRNDEERTAVLAYVKSLKVELESQKYSGESIRVMIDDRDLRGGEKNWQHVKKGV
PLRAEIGPKDIAKNGVFLARRDTGEKVGVGREDLVATIADRLDAIQKNLFDRALAYREEH
TRNVDSLDDLIAWFTPKNTAEDKAEIHGGFAMCHLVDEPAVDELLKKHRLTVRCIPLAGA
VDEGTCIVTGKPVTKRVVVAKSY
Download sequence
Identical sequences D2R7X6
gi|283782412|ref|YP_003373167.1| WP_012913566.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]