SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268679084|ref|YP_003303515.1| from Sulfurospirillum deleyianum DSM 6946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268679084|ref|YP_003303515.1|
Domain Number 1 Region: 123-400
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.22e-65
Family RecA protein-like (ATPase-domain) 0.0000000491
Further Details:      
 
Domain Number 2 Region: 81-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.97e-23
Family Cold shock DNA-binding domain-like 0.0003
Further Details:      
 
Domain Number 3 Region: 34-79
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000000824
Family Rho termination factor, N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|268679084|ref|YP_003303515.1|
Sequence length 447
Comment transcription termination factor Rho [Sulfurospirillum deleyianum DSM 6946]
Sequence
MSGNTPTSNTQTPAQSKPTHYTKSRTHVPVDGYKIENLRTIPLEKLLEIATELGIENPNE
LKRQDLMFEILKSQVNQGGFILFTGILEIAGEGYGFLRATDANFSDSANDAYVSSTQVKK
FALRTGDIVTGQVRPPKDQERYYALLKIEAINYLPLAESKKRPLFENLTPLYPTEKIKLE
YDPMKITGRVLDLFTPLGKGQRGLIVAPPRSGKTELMKELAHGIARNHPEAELIVLLVDE
RPEEVTDMQRCVQGEVYSSTFDMPASNHVRVANLVIEKAKRRVEMGKDVIILLDSITRLA
RAYNTVTPSSGKVLSGGVDANALHKPKRFFGAARNIEDGGSLTIISTALIETGSRMDEVI
FEEFKGTGNSEIVLDRNISDRRIYPAVNIMKSGTRKEELLLSPDTLQKVWALRSAINQME
DIEALKFLYAKMLKTKDNEELLSIMNE
Download sequence
Identical sequences D1AZL3
525898.Sdel_0443 WP_012856246.1.51747 gi|268679084|ref|YP_003303515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]