SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268680105|ref|YP_003304536.1| from Sulfurospirillum deleyianum DSM 6946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268680105|ref|YP_003304536.1|
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 7.6e-39
Family Deoxycytidylate deaminase-like 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|268680105|ref|YP_003304536.1|
Sequence length 146
Comment cytosine deaminase [Sulfurospirillum deleyianum DSM 6946]
Sequence
MMDKFLEAAIEEAQKGLDEGGIPIGSVLVIDGKIVGRGHNQRVQKGSAILHAEMDCLENA
GRLSAADYRNATLYSTLSPCDMCSGAILLYGIPKLVIGENQTFRGPEAYVKSRGVDVEVL
NDSKCRELMEAFIEKNPELWNEDIGV
Download sequence
Identical sequences D1B331
525898.Sdel_1483 gi|268680105|ref|YP_003304536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]