SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268680676|ref|YP_003305107.1| from Sulfurospirillum deleyianum DSM 6946

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268680676|ref|YP_003305107.1|
Domain Number 1 Region: 4-259
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.44e-67
Family FdhD/NarQ 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|268680676|ref|YP_003305107.1|
Sequence length 262
Comment formate dehydrogenase family accessory protein FdhD [Sulfurospirillum deleyianum DSM 6946]
Sequence
MEPVFKTTITKIKGKEKFEREDTLVREIKLELIVNGNRVGAVMATPVDQEALAIGYLMSE
NIIEKLSDVTSLKLLNDGMRVEIEAKVNEESIHKLNAEGVVISGCGKSMTANIDPEAIAA
KVIQSPFKLSSRKLSTEMSQFYTECPLYEQTGCVHTAKLFTDEHTYFIGEDIAQHNTIDK
VVGKAVLAGADVKNAFLMVSGRLSSEMVAKAVMHQIPILASRTASTCLGLMIAEKFGLTL
IGFVRGDTMNIYRHPQRIVVEA
Download sequence
Identical sequences D1B4Q2
525898.Sdel_2060 WP_012857817.1.51747 gi|268680676|ref|YP_003305107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]