SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261402351|ref|YP_003246575.1| from Methanocaldococcus vulcanius M7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261402351|ref|YP_003246575.1|
Domain Number 1 Region: 85-185
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 2.62e-29
Family Ribosomal protein S3 C-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 6-94
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.88e-26
Family Prokaryotic type KH domain (KH-domain type II) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261402351|ref|YP_003246575.1|
Sequence length 206
Comment 30S ribosomal protein S3 [Methanocaldococcus vulcanius M7]
Sequence
MIERTFVKEHIKEFLIDEYFKKELSRAGYSHCYIRKTPIGTKIIIYAEKPGFVIGRRGSR
IRELTETLAKEFGVEKPQIDVKPVENPDLDAQVVAQKVAQSLERGMHFRRVGHTAVRRVM
NAGAKGVIVIISGKLTGERARTEKFMAGYMKHCGEPAEELVDKGSAIAKTKPGVIGVTVK
IMRPDVLLPDEIIIKDTEVEHVVEEE
Download sequence
Identical sequences C9REU1
579137.Metvu_0226 WP_012819637.1.10243 gi|261402351|ref|YP_003246575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]