SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261402398|ref|YP_003246622.1| from Methanocaldococcus vulcanius M7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261402398|ref|YP_003246622.1|
Domain Number 1 Region: 104-223
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.29e-29
Family MJ1460-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261402398|ref|YP_003246622.1|
Sequence length 229
Comment 4-vinyl reductase 4VR [Methanocaldococcus vulcanius M7]
Sequence
MANAMKVIEMLRIIDNRAKFMGIKLTMMKNLLEKYKDNKDLLKEVLKLTEGTRLHDLILE
AYPPLEELKREIKEEELEVKKEPEISTNLPKKDFCVFEGRVSLIAYIKEYLRKYYLGNNV
KKIFYEIGKDYAIRLGINSYEEMIRFMNEDFGEVSIEHCEPLTIIVKNNKECKNCKASEP
ICYLTAGFIAGCLENMVNKLYLVEVTEEKCQAIGDPFCAFIAKKSIKLS
Download sequence
Identical sequences C9REY8
WP_012819684.1.10243 579137.Metvu_0273 gi|261402398|ref|YP_003246622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]