SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268315753|ref|YP_003289472.1| from Rhodothermus marinus DSM 4252

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|268315753|ref|YP_003289472.1|
Domain Number - Region: 119-180
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.022
Further Details:      
 
Domain Number - Region: 189-253
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|268315753|ref|YP_003289472.1|
Sequence length 259
Comment protein PASTA domain-containing protein [Rhodothermus marinus DSM 4252]
Sequence
MKRLTGLIQLLRNPYLWGGLFALLIATLLVYLVVDQWLMPAYTRHGVVQYVPDVRQLPYE
QAAQILQAQGLRPERIPVRRFRSDLPVETVLDQTPPPQAAVKPGRRVYLTVNAGRNPMVT
VPSVIGMSLREAVNRLTALGLRADDLRPDTIPSPYARTVTRQHPAPGDSVAEGGTVTLWY
STGLGQRFVTVPDVTGRTVAEAQRILLEHRLRSVVVEPREVTETTGDTTRIVIRQSREPG
TQVREGFEIRLFVAPPDTL
Download sequence
Identical sequences D0MCX4
gi|268315753|ref|YP_003289472.1| 518766.Rmar_0178 WP_012842696.1.83145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]