SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268318246|ref|YP_003291965.1| from Rhodothermus marinus DSM 4252

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268318246|ref|YP_003291965.1|
Domain Number 1 Region: 216-555
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.86e-95
Family beta-Lactamase/D-ala carboxypeptidase 0.00015
Further Details:      
 
Domain Number 2 Region: 45-215
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 8.89e-40
Family Penicillin binding protein dimerisation domain 0.002
Further Details:      
 
Domain Number 3 Region: 638-683
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|268318246|ref|YP_003291965.1|
Sequence length 689
Comment peptidoglycan glycosyltransferase [Rhodothermus marinus DSM 4252]
Sequence
MLTRLYVVLTLMALWPLAIAGRMLWIYLSEGAALRAEGRRQMRAVVEIPAMRGEMLDRVG
RALAVNTVRYDLALDPEVEGFAAQGSTFFERLARLTGRSATYFRQRVARRASPRYVVLWR
GLTEAQKKAIESWEVPGVILEPRFSRWYPYGSLAAHVLGYVGADGRGLAGLELQYDRYLQ
GRPGRRVVQRDRRGVLKPMVGGEVVEPEHGQTLVLTLDLIRQTILEEELARGVAEAGARW
GTAIAMDPRTGAVLAMANVPTYDPNRPAAASEEARRNRAITDRMEPGSTFKLITAIAALE
QGVVALDDTIDTGAGWAVFAGRTMRDVHAYGRISFAEALVHSSNVGIAKIATRLKPGALY
QYARNLGFGQPTMIDLPGEVSGTLKRPSRWSGTTLTSMSIGYEVDATPLQILTAYCALAN
GGLLVRPFVVAERRSITGEVLWHARPDSIRRAFRRETVRRLLPVFERVVNEGTGRAARVE
GLPVAGKTGTAFKVVDGRYQPGAYRASFVGFFPADDPQVALIVVLDEPRRSIYGGQVAAP
IFRRVAERWIGTFPKIAERMAPREELPEQVARPLPILEGQPLAVAHARLQAEGLRVRVAG
PDEVLAFVTDQHPAPETPVTPGDAVRLEVTPPDTLVRRMPDLRGLSARQATYWLATYGVG
VRVEGHGQVVAQWPEPGAPLPSEVYLRCR
Download sequence
Identical sequences D0MGL4
gi|268318246|ref|YP_003291965.1| WP_012845187.1.83145 518766.Rmar_2706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]