SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268318313|ref|YP_003292032.1| from Rhodothermus marinus DSM 4252

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268318313|ref|YP_003292032.1|
Domain Number 1 Region: 190-352
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.11e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 447-583
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.11e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 325-460
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0012
Further Details:      
 
Domain Number 4 Region: 80-188
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.01e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|268318313|ref|YP_003292032.1|
Sequence length 599
Comment precorrin-3B synthase [Rhodothermus marinus DSM 4252]
Sequence
MQHMPDLPFSEEQKQYLQGFMAGVLQRGGLSFVGQTADGRLTHEPEQAVRDLATPAPAET
LYGTPIDRLCKQERIKLELHPLDMWDRVLENAAAGRFPEGDDVFRYKALGLFYVAPAQNA
FMLRCRIAGGFLSSRQAHGLAELAERYGAGYLDLTTRANIQIREIGARDAADVLMALADL
GLTSRGAGADNIRNITATPTTGFDLQELYDVRPLVRSLYYYILNSRDLYNLPRKFNVAFD
SGGVITAAADTNDLGFVAVRVDEGHDVPPGVYFRIELGGVTGHGAFAQDTGYMVPPEACI
ATAAAIIRVYLENGDRTNRKKARLKYLLERWGVERFMEAVQERLAFSLIRFPREACTPRP
PLRPGAHIGIHPQRPEGHYYVGVDVPVGRLQAAQLHGLADLAERYGAGELRLTVFQNLLI
PGVAEADLEPLCAALRELGLSHESTPLRQGLVACTGNAGCPYARTNTKAHALALARYLEE
AGISVDRPLNIHLTGCPHSCAQHYCGDIGLLGVKVKTDSGETVEGYDIVLGGGLEAAQGL
AREVARGIPFEAVPPLLAHLLRTYLQQRQGDESFAAFTRRLDATTLETILAESKPDATP
Download sequence
Identical sequences D0MGT1
gi|268318313|ref|YP_003292032.1| WP_012845254.1.83145 518766.Rmar_2774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]