SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262193403|ref|YP_003264612.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262193403|ref|YP_003264612.1|
Domain Number 1 Region: 179-243,272-382,431-588
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 5.49e-16
Family Nitrous oxide reductase, N-terminal domain 0.041
Further Details:      
 
Domain Number 2 Region: 793-827,933-1022
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000155
Family monodomain cytochrome c 0.072
Further Details:      
 
Domain Number 3 Region: 570-710
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000518
Family monodomain cytochrome c 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262193403|ref|YP_003264612.1|
Sequence length 1023
Comment hypothetical protein [Haliangium ochraceum DSM 14365]
Sequence
MQMSRRVKRDATQWSAWLCAALMTGGLLGCDSGSDGSMDAGLDDGYDWDCPDYIGPGYRP
TTCGGRGGPDIPFVDDRPWSLDPVFDMLRADELARFESGGVTLSEDDFTASEIPNSVAAQ
FERIYAVLGAERGSGSAAPDTEFQARAENMPFRAHPSDVKLYRGNNERRAIVPLGGSIDV
PGNEVAIVDLETQSVTRVAVGLRPQRVAVLDDAGLALVCNQYSNYISVIDLLENDLLIDP
DGGPETLLTSTYCSDIALVERRPGVGRIDELYLYVLSEYDAKVMRYRIDIVRDINNAPVD
VIISNGVENVAPVPVPEREAFGIGDSPHRLQFSEDGTRLLVTNDRGSDLALVDAETLEVL
ARRDVGAPTLAAASIGGQFLATTTTPYRGLLRAGDEVPEEVSAEPRLAEGVDGHMYEVHP
GAQFDATASYNYEDVRSGILVFDADLADEPVYYTDDNEADALFAEENKLLAGALPWDIAR
DNAGAFAYVALLGSDLVQELAVTRENGLRLAASGRSFATSELPAAVALDEGADALLVATR
GGGFLEVFDRTSGERTAQIDLGYASPRYPATAVEAGEYFFASATWSNDGRKSCVSCHLSE
FITDGLSFSQGTTAPTSANAVQPVHNLLRSNTFGWSGSAVQDEMVRFSVQAQTRSNCELL
LYGLVDGLGVAPAERGGDPANFTAELDTTGCVADTANQINGLPAPLANADRNGDGAVDFL
DIQAAIAAQDELASEAVSAAVQPQLERVGLYDAGDAAGNREAVIRALWFYSVSQQRLPPN
PYAQRMRLGLYGPAESEYYQAGRDVFLNKAECDACHIVAAEGATSPFTDGRRHGAGGDFA
ERFTRVFEFDPLLAEIPGFDSGFPQQLKLASAYGDSKQEQSFVQAEVDSWKPLCFDTSRC
LDMGNPLSAGPGSDEEFERMYRLGVIGFAQPGGFGFVPGFLFGEVAFDTPSLRGLWMRPR
LLHHGRARSTREVILPPGDGLLDVGEAGYGINRFHERYRHGWDTDALSEADLQALSFFLR
AIE
Download sequence
Identical sequences D0LGH3
502025.Hoch_0078 gi|262193403|ref|YP_003264612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]