SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262194629|ref|YP_003265838.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262194629|ref|YP_003265838.1|
Domain Number 1 Region: 174-225
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000269
Family Fibrinogen C-terminal domain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 126-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000695
Family EGF-type module 0.047
Further Details:      
 
Weak hits

Sequence:  gi|262194629|ref|YP_003265838.1|
Domain Number - Region: 101-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0024
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262194629|ref|YP_003265838.1|
Sequence length 428
Comment EGF calcium-binding domain-containing protein [Haliangium ochraceum DSM 14365]
Sequence
MPRSELVIHRLKRAERAVFRGYLALVMLLGACFAPEYPQGIPCSGRQTCPPGQTCGADDV
CRVTPLPPTPGEDATPVERDAAPVEMDAAAPDSTPAPSCADCDVNASCDADAEPIFCQCD
AGYAGDGFSCADIDECAADQPSHDCSPDATCTNTPGGHLCACNAGFFGDGSSCRRARSCA
DLLALAPATGTGVYTIDPDDVGAVAPFEVFCDMDREGGGWTLLFVSSDDGADTWTITART
RMTTDTTPIGDLGDTARDFKSPAYHALPFRALLFVHQPSGITAAYGDVGDGSGDFGSFLA
GVEYPVCDFALAGNGHELTGGTLTPQTLLCDTDLYFNLGDHESRSVATCSDPTAGSNNNT
FGPGWSITNNAACPFDDPSLAALGPQDSCAGCNDVSALESNARGFGNHLGLNTGAAGQAE
NYIQMYAR
Download sequence
Identical sequences D0LUQ5
gi|262194629|ref|YP_003265838.1| 502025.Hoch_1391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]