SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262195014|ref|YP_003266223.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262195014|ref|YP_003266223.1|
Domain Number 1 Region: 132-185
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000344
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|262195014|ref|YP_003266223.1|
Domain Number - Region: 92-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262195014|ref|YP_003266223.1|
Sequence length 372
Comment EGF-like domain-containing protein [Haliangium ochraceum DSM 14365]
Sequence
MSRWFWVGVSFLLGGCFAPNYPEGVACSQAQTCPPGQRCDPASSTCRVSAPEPADDAGAA
PDSAGPTPADAGAARDGGGGAVDAAASDAGPGPCADAPCGDNASCSVSDDAPEGYACTCA
AGFVPRAAEPGCRLPRSCRELLGAQPDSGDGVYSLAPEGEAAGAALASYCDMSTDGGGWT
LVQRTVWAFSDSGALRTDYQSFREQTIGAPAPGQAFRAPARLWPLLQETREHLMREVPRR
ASDGGDCGALYYTASEGVWSVPAGGGATLTGAVDPNILFNGTTALSALDDGPSTDCVADY
QAVPWLYERCCSTCPTFENNYWRDEPHPMSSRMNIADLFGETMFTQCAPAEPRRSDNNST
FYGINVMEYYLR
Download sequence
Identical sequences D0LXX5
WP_012826938.1.83622 gi|262195014|ref|YP_003266223.1| 502025.Hoch_1781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]