SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262198773|ref|YP_003269982.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262198773|ref|YP_003269982.1|
Domain Number 1 Region: 260-533
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.2e-18
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.032
Further Details:      
 
Weak hits

Sequence:  gi|262198773|ref|YP_003269982.1|
Domain Number - Region: 142-291
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0162
Family Nitrous oxide reductase, N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262198773|ref|YP_003269982.1|
Sequence length 607
Comment selenium-binding protein [Haliangium ochraceum DSM 14365]
Sequence
MNRKSIALLSAMSISALLITACGNSSSRNAEGTNPQASAAGSHGSGTPSPAIGESFQRGI
VLQIDGEDYFMDGPLEDARRDLPGHSWVKLGPGLVWGRHVNTGPFGLPKWWSSDAEDGQH
LFDVLGIVDEWTPEKAESYRALGFSHYHELVTVEGRTPHPSKVMWFQHIAQGSFTVDGGF
KPWMRNEVTAGLVPDFMPNAHVPYPHRETYLYIGCVDVGGKDPDFMLVVGADPNDPKTYG
KIVHREDMPKLGDELHHYGFNVTQTRMIVPGLFSGRIHVLDIATDPARPTLIDYHEDLTP
NSGYTTPHTVIGMPDGGYVLSMIGSNTDTTAPGGLVKLDANARVEGHFGPGPNRDSSEAP
PKFMYDLGINPLRNRMITTAFGLPANIGGGINVAGLGDELYVWDFKKREVLQVENLGPGT
GPLEVRWLEEPGAPVGFTNAPGTSQIWRWKDLDLDGTYEFEVAIQLPEGSVPTDILLSHD
DKYLYVSNWVGSNVMQYDISDPFDPKLVAQVPVPDSQMMRLSPDNKRLYVTNSLLSTWDD
DEFPEGVTRNQNYGIFLINIDHENGGMTLDEDFHVDLMKVKKKNTVGAARPHQVFFDRGV
PRKFGEH
Download sequence
Identical sequences D0LG64
502025.Hoch_5609 gi|262198773|ref|YP_003269982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]