SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262195269|ref|YP_003266478.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262195269|ref|YP_003266478.1|
Domain Number 1 Region: 8-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.41e-49
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262195269|ref|YP_003266478.1|
Sequence length 339
Comment CheB methylesterase [Haliangium ochraceum DSM 14365]
Sequence
MSQTSTQHERVLCMGASAGGLTALRRLVAELPADFPAPICLVQHTPSDGPRLLDGLLTQA
GKLRARFAEDGEPLTAGTIHIAPPGMHMVIDDGRLRHVRGPRENLARPAIDPLFRSAALH
FKQQTIGVLLSGMLDDGVAGLSVIERCGGVAVIQDPEDAEAADMPQNALDAIGERLAAVL
PADALGRYLRELRTVEPRTGANCPEHLGAEHRMFVAASGIDVVPMIGDPAALSCPTCGGP
LWEMPDEDVRRYRCHVAHGFTTQCLGEEQRTGMEEALWAAVRTLDERVKTLGVMIQDAEK
RGYRRIVDMYSDERKEAKRHADALRELFLGNLDKSPKGN
Download sequence
Identical sequences D0LFY3
502025.Hoch_2040 gi|262195269|ref|YP_003266478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]