SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292494037|ref|YP_003533179.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292494037|ref|YP_003533179.1|
Domain Number 1 Region: 159-340
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.13e-18
Family TAP-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292494037|ref|YP_003533179.1|
Sequence length 344
Comment hypothetical protein HVO_B0098 [Haloferax volcanii DS2]
Sequence
MQHDDIQHDDVQFHNVRALQRVRPHEGLRLLRVPEAVRSGLNTGAQTRMSHPAGTEIRLV
PDETVRITLSSEERDSLVRPFWGDFQATGEEFTLGPEPKTVELSPPESLSDLDPAATGEM
RYAPEVCRLVFPGDHRGGHIYYHGVEGARRPPTADEVPSLRYLAYGTSITEGEDPSAEML
TYVNQTARRLGADPINLGSCGTAYCDPAMAEHIAARDDWDVATLSLSVNMVGRFSPDEFR
ERAADMVETVAAANPTKPVACITLFPHVREYKRDHEEATLSETFRQHLRDVVDECGYDNV
HLVEGPDLLPTASGMTTDLVHPGDDAMVRIGERLARELESLMDD
Download sequence
Identical sequences D4GPA0 L9VHZ7
WP_004041057.1.66890 WP_004041057.1.84848 gi|292494037|ref|YP_003533179.1|NC_013964 gi|292494037|ref|YP_003533179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]