SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292654999|ref|YP_003534896.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654999|ref|YP_003534896.1|
Domain Number 1 Region: 8-61,200-403
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.29e-49
Family Bacterial dinuclear zinc exopeptidases 0.0077
Further Details:      
 
Domain Number 2 Region: 64-193
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000837
Family PA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292654999|ref|YP_003534896.1|
Sequence length 435
Comment aminopeptidase [Haloferax volcanii DS2]
Sequence
MSDWIGDTFTSEVGWNHLERLVDIGNRMTGSPGEREAMEATRDALERVGARNARIDPFEI
QGWERGDSAVYAADTTQDCIALPRSPAGTASGELVDLGYGLTEDFDRDLSGKVVVVSTTV
PDHYDRFIHRREKYYYAVEAGAAAFVFANHVPGQLPPTGSVGTADAPIGDIPAVGVSKEV
GARLRRRFDGDEVTVDVTCEAPAAESGNVHAELGPDTDEEVLVTSHLDAHDIAEGAMDNG
AGTAMVVEVARALAAREDELDTRVRFVCFGAEEVGLVGSEYEAERLGDDRANVKAIVNND
GVVAGRTLKLTTHGFDELEAAAETVAERFDHDVSTLPEQLPHSDHWPFVAHGVPAYMVGS
EKEGRGRGWGHTHADTIEKLESRTLREQAILLTELTVELADADREIPHADPADIAAALEA
EDQAEGMKVTGDWPF
Download sequence
Identical sequences D4GUH5 L9UNL2
WP_004044100.1.66890 WP_004044100.1.84848 gi|292654999|ref|YP_003534896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]