SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292655984|ref|YP_003535881.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292655984|ref|YP_003535881.1|
Domain Number 1 Region: 10-68,209-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.86e-39
Family Bacterial dinuclear zinc exopeptidases 0.014
Further Details:      
 
Domain Number 2 Region: 85-214
Classification Level Classification E-value
Superfamily PA domain 0.000000000122
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292655984|ref|YP_003535881.1|
Sequence length 444
Comment aminopeptidase [Haloferax volcanii DS2]
Sequence
MDDLSPAVREAFARTWVDDRPWAFLTDLTAIGDRMAGGPGDRRASTLVADAFTDAGVRRV
EFDPFEMARWTRGDTTLDLTAPDERRFEAVALPYAPPATVSGPLVDVGYGTPSEIDAADV
DGALVVASTTTPAGGRFVHRMEKFNYAIGAGAVGFVFVNHVPGQLPPTGALRYDEEAAAP
AVGVSAETGSWLTDYAARGGEATLAVGAETTPGESRNVEGRVGPDTDRELLLCAHFDAHD
IAEGALDNGCGIAVVVTAARLLAEMDLALGVRVVGVGAEELGLTGSEHLADRLDLDRVAA
VVNVDGAGRFRDLVAHSHTSEATAAVATRVGNETRHPVDIEPEPHPFSDQWPFVRAGVPA
LQLRSESGERGRGWGHTHADTRDKVDDRNVREHGMLTALIVRELAATAADGEIPRLDDEL
AAAFRDADFETGMKAAGIWPDGWE
Download sequence
Identical sequences D4GSV2 L9VEG3
gi|292655984|ref|YP_003535881.1| WP_004041731.1.66890 WP_004041731.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]