SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292656226|ref|YP_003536123.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656226|ref|YP_003536123.1|
Domain Number 1 Region: 23-199
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 9.03e-45
Family Aromatic compound dioxygenase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292656226|ref|YP_003536123.1|
Sequence length 264
Comment putative dioxygenase [Haloferax volcanii DS2]
Sequence
MSTDDPDYPATGTMTDTSVTTSDGTTACVAQPELTEGPYYVDENLRRSDIRADSDTGEQE
DGVRLDLGFKVFELTEDSCTPLDNAIVDVWHANASGVYSDVEMQNTVGQDFLRGIQLTDD
AGAASFTTIYPGWYTGRAVHIHFKVRSSDDATEAYEFTSQLFFDDDLTDRVYTQAPYADR
GDRDTLNSEDNIFQQDNAAQLVLDLTETSEGYSGTLNVALYTSGETAADDSFSAGGGGPG
EPPNGSEPSSDSNPPATMNDTTTE
Download sequence
Identical sequences D4GUP6 L9V9L1
WP_004041983.1.66890 WP_004041983.1.84848 gi|292656226|ref|YP_003536123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]