SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292657108|ref|YP_003537005.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292657108|ref|YP_003537005.1|
Domain Number 1 Region: 29-337
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.8e-103
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000225
Further Details:      
 
Domain Number 2 Region: 421-608
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.17e-49
Family NAD+-dependent DNA ligase, domain 3 0.0000705
Further Details:      
 
Domain Number 3 Region: 339-413
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.17e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00083
Further Details:      
 
Domain Number 4 Region: 615-691
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000106
Family DNA ligase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292657108|ref|YP_003537005.1|
Sequence length 699
Comment NAD-dependent DNA ligase [Haloferax volcanii DS2]
Sequence
MSDADVDAESNPYLRDPPTEFEPAESLSREAAEGQAALLREAVREHDHRYYVAADPLVSD
AAYDALFSRLVALEDAFDLDTTNSPTNRVGGEPIDALETVEHVAPMLSIDQSTDADDLRE
FDERVRREVGAVDYVCEPKFDGLSVEVVYEDGEFVRAATRGDGRRGDDVSAQVKTIPTVP
LSLRGDHPDRLAVRGEIYMPKSDFSDLNARRVEAGEDAFANPRNAAAGTLRNLDPSVVAD
RPLAVFFYDILDASARPDSQWAALDRLREWGLRVTDRIERAEDVAEAIDYRDRMQAARDD
LDYEIDGTVIKVDSRDARERLGEKSRSVRWAFAYKFPARHEVTTVRDIVVQVGRTGRLTP
VAILDPVDVGGVTVSRATLHNPDERAALGVAVGDRVRVKRAGDVIPQVVEVTEDGGGCYE
FPDECPVCGSAVDRDGPLAFCSGGLSCPAQREASIGHFAVKGAMDIDGLGEERVAQLVDA
GLVETVADLYDLTADDLAELEGWGETSAENLVAAVENAKHPSLDSFLVGLSIPEVGEATA
RGLAREFGSIEAFPIEADAEEDEFDAFEERLTTVPDVGETVARRVRDFFENADNRAVIRA
LLDRGVDPEPVESGGDELDGLTFVVTGTLAASRSDVTELVESHGGNVTGSVSGNTDYLVV
GENPGRSKRDDAEANDVPTLAETEFEALLAERGVAYPPE
Download sequence
Identical sequences D4GY98
gi|292657108|ref|YP_003537005.1| WP_004044909.1.66890 WP_004044909.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]