SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294494742|ref|YP_003541235.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294494742|ref|YP_003541235.1|
Domain Number 1 Region: 241-606
Classification Level Classification E-value
Superfamily SIS domain 4.08e-110
Family double-SIS domain 0.000000131
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.72e-69
Family Class II glutamine amidotransferases 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294494742|ref|YP_003541235.1|
Sequence length 606
Comment glutamine--fructose-6-phosphate transaminase [Methanohalophilus mahii DSM 5219]
Sequence
MCGIVGYVGKTGASSVIMDCLRRLEYRGYDSAGLSVLNGDLQTYKAAGSISELDKVLPAE
IKGNIGIGHTRWATHGMPNDVNAHPHCSSDIVVVHNGIIENYLKLKEWLEDEGYEFVSDT
DTEVIAHLVHFNSNSLDLFEAVHKSMAVLEGSYAIAVMSKNNPDTLIASRKDSPLIVGLG
ENEFFTSSDATAFVAHTRDVIFVDDREIVKLTPEKVEFYDMEGQLLEKQISTIDWDVEAA
EKSGYAHFMLKEIHEQTRSLQKTFAGKLAELEGNVRLTELKLTDEQIRNINRVEIIACGT
SWNAGLFGKYLLETLAGMHTDVSAASEFRYRDPVMDENVLTIAITQSGETADTLAAIRNV
VQYESSTIAITNVVGSTITREAENVVYTHAGPEIGVAATKTFTAQLIALYLLAIYMGRKR
NYLLPDEAKDVIKALKELPGHVQQVLNQRDQIRKNAAQYADCRDYYFIGRGLNYPAALEA
ALKLKEISYIHAEGYAAGELKHGPLALLEKGTPVVAIVTKNRTYAKMLSNIKEVKARGAE
VIAVADERDREIGKYADLVIFVPATNPLLSPVLSSVALQLLAYYTALEKGCEIDKPRNLA
KSVTVE
Download sequence
Identical sequences D5E8T1
gi|294494742|ref|YP_003541235.1| WP_013036533.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]