SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294494797|ref|YP_003541290.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294494797|ref|YP_003541290.1|
Domain Number 1 Region: 82-123,189-604
Classification Level Classification E-value
Superfamily Subtilisin-like 2.09e-65
Family Subtilases 0.000000305
Further Details:      
 
Domain Number 2 Region: 901-1012
Classification Level Classification E-value
Superfamily PKD domain 2.09e-21
Family PKD domain 0.00016
Further Details:      
 
Weak hits

Sequence:  gi|294494797|ref|YP_003541290.1|
Domain Number - Region: 753-824
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000687
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294494797|ref|YP_003541290.1|
Sequence length 1241
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Methanohalophilus mahii DSM 5219]
Sequence
MGIPHSFLAFSIKEVIYIINQMKMMDYRVVSVTILFLLLCSFFTCSAALAKNSDTPFDHI
FLKNATINPGQTPLVGTNTVTISNDGSKGYYLVQFQNPILPDWKVQIEKISEISGYVPEN
TYILHLNGSQINRIKSLPYFKWMGEYKPEYKVDPDLYGLDGETIIVISTFKSNSAELKNS
LLEMDASLVAENGNQIRVKINGSVIPLIAQCANVVWIEPYNPPVILNDKAGEIIGVDRVA
SPHNLTGANQTIAIADTGLDTGNLSTLHPDIGGRVDALYDWSDGNPADNNGHGTHVAGSA
LGNGYLSAGQYKGMAPEAHLFFQACGDGSKTLNIPPLNQLFIEAYNNGSRIHSNSWGSSS
SYATDAKALDNFTWHHPDMLILFAAGNDGPSTGTINSPGIAKNALTVGASENYRPERGGD
SDNPSDIADFSSRGPTFDGRIKPDIVTPGTSIYSTASSLVYPEDYVYMSGTSMATPVTAG
SAALIRQYFMNNIPIHPSAALLKATLINGAVDLNHSYYSQGWGRLDLTKSIDPVFPAHIR
LHDNINLSTNTSWTAKYYVDNTQTPLKATLVWTDYPATASASKALVNNLDLVITSPNYSK
YYGNGAPDNVNNVEQIQIDSPEAGWYSFSVNGTKVPQGSEQPFAFVISGGSLNNETVVKK
ATVEPESIGASGPENAILKVELNEHLVNSAVYADLSQLGLPSQQNLTNNSGIWEYELNSK
SEGTYYFGINVTYNESSYDNSTFVKLNIIDNIPPANVTDLYPVNTGYSWINWSWTNPNDS
DFSNSLVYIDGIQEATLNRTHYNATGLFPNTSHTISIRTVDNNGNINQNWTNNTSGTQTD
VIYPQIHDIMVNNSENLTAGELLEITVNSTDDYMLSEVLANGKQLSNLEGTLWRGNLVIL
PGMQYINISAMDTSGNKVWNNSTCYSGLIMPQAHFTSNVTSGKVPLSVQFNDTSHNATEW
NWDIDGDSSIDYAIQNPSHVYNKTGAYSVTLTVNNTNGTDTYSFENYIEVEPRNPATNGG
GSGGGGGSTTAEDYSNIIFKDFSIRSITVDEPVTYEFKEPKNPVRQIDLISARNAGQVKF
TVELLKNTSSLVNKPSAGLVYHNLNIWAENSAFSENIQNSSVIFRIDQDWFDQENVDVKD
IVLEVFENGTWIALPTEYINKSTNYLYFKADTDRYLNAPFVIMGTEYIKEIEEPIAEKPE
LEPQSEKESQSENQDAQTPGFTGMFVVALIAGAALVMRKRI
Download sequence
Identical sequences D5E8Y6
WP_013036588.1.50250 gi|294494797|ref|YP_003541290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]