SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294494922|ref|YP_003541415.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294494922|ref|YP_003541415.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.09e-35
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 160-283
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.85e-32
Family TyrA dimerization domain-like 0.00089
Further Details:      
 
Weak hits

Sequence:  gi|294494922|ref|YP_003541415.1|
Domain Number - Region: 355-426
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.0536
Family Anticodon-binding domain of PheRS 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294494922|ref|YP_003541415.1|
Sequence length 435
Comment prephenate dehydrogenase [Methanohalophilus mahii DSM 5219]
Sequence
MKILIIGGTGEMGQWFANFFKKRGYEVWLSGRGGKSEVAERLGVHFTAEPDIVIPTCDIV
IISVPINITPTIIAQTAPKMKKGSLLMDLTSLKKKPVEAMKKYVPENVEFLGTHPMFGPS
IPSLQGQTFILTPVEGRCDQWFDHIFNLLSEEEASIEVITPDEHDHFVSIVQGLTHFAYI
TIGATMQKLDFDVKGSRRFMSPVYDIMLDFVGRILGQNPELYALIQMENPEVIRVHDIFI
EQCRHFSSMVRSHDTGQFCEEMKAAALHFGDTASALRRSDKLINSKVAEFEELVHSTGHE
KGLLHIYSRKTHVGIVKRVTSNNVTLKEGKKELQLKIGNIRILSADELNHWKENKLKPIL
RDISVFVPQSAKPFTIQQILDCRIEGVKVETIDTYLHKKGPTATFRLKIRGDLDAAEIHR
EMEELLEGMGCTLRK
Download sequence
Identical sequences D5E9B9
WP_013036713.1.50250 gi|294494922|ref|YP_003541415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]