SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294494942|ref|YP_003541435.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294494942|ref|YP_003541435.1|
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000000000141
Family CopG-like 0.0015
Further Details:      
 
Domain Number 2 Region: 56-92
Classification Level Classification E-value
Superfamily ACT-like 0.0000000366
Family Nickel responsive regulator NikR, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294494942|ref|YP_003541435.1|
Sequence length 94
Comment CopG family transcriptional regulator [Methanohalophilus mahii DSM 5219]
Sequence
MEQELMRIGVSLPNNLLEKFDSIIEQRGYSSRSEGIRDAIRSYINYHEWMGDISGRRVGT
ITLIYDHTKRGLSNAIADAQHGYTDIIKTSIHPS
Download sequence
Identical sequences D5E9D9
gi|294494942|ref|YP_003541435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]