SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495054|ref|YP_003541547.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495054|ref|YP_003541547.1|
Domain Number 1 Region: 58-259
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-55
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00076
Further Details:      
 
Domain Number 2 Region: 308-520
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.48e-47
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000887
Further Details:      
 
Domain Number 3 Region: 603-751
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.97e-41
Family AlaX-like 0.0051
Further Details:      
 
Domain Number 4 Region: 509-597
Classification Level Classification E-value
Superfamily Translation proteins 5.3e-16
Family AlaX-M N-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495054|ref|YP_003541547.1|
Sequence length 924
Comment alanyl-tRNA synthetase [Methanohalophilus mahii DSM 5219]
Sequence
MLEEEYDINFFYENGFIRKQCQKCGSYFWTRDRDRDTCGDAPCDPYSFIDNPVFKKKFNL
AQMREFYLSYFEKNGHTRIERYPVIARWRNDIYLTIASIADFQPFVTSGQVAPPANPLTI
SQPCIRLSDLDAVGRSGRHLTTFEMMAHHAFNKKSNEIYWKDRTVQLCDGLLNELGVDPF
AVTYKEEPWAGGGNAGACVEVLIGGLEVATLVFMNLQQSKNGDIVIKGDTYRKMDNYIVD
TGYGLERLVWASQGTPTVYDAIFPEVVGELMELAGVEHRLEDEDYANILSQNARLAGLMD
VSEKANLLELRKQVASNIGITADKLGTIMEPVETAYAIADHARCITFMLGDGIIPSNVKA
GYLARLVIRRTMKMMQDLDIKIPLSDIVQMHINHLPEYPEFADRFDVISDILDNEEKKFQ
ETLQRGKKLIQKSAKHYKKKGEKMPLDTVIDMYDSHGIPAEISREAASEVGVEVELPDNF
YSLVAERHSKSVQEHEKEIPYADRLKKLPPTKRLFYDEPNRMEFEAVVLDVFDNNIVLDS
TLLYPEGGGQPPDHGTFMVDDALLKVIDVQIFDGIVIHTIEEIEDELHIRKGDMVTGKVD
EKRRMAHARNHTATHIINDAARQVLGEHIWQAGAQKFADRARLDISHYKRIVPEEINEIE
MIANQMVMENKRVISEWMDRSTAEKRYGFSLYQGGVPPGDRIRVLHVGSDIEACAGTHCT
FTGQVGPIKILKTERIQDGVERIEYAAGEAAVVAFQERDKLLRSSAETLRVATEQLPTTI
ERFFTEWKEFKKENTRLKKELAESRVNQLVENAEQLKEIRLINSRVDGADADELTRMAGE
LASSDDIVALLISDHEGAKIAAAAGDSAVSKGINVGNIVREIANLTGGGGGGKPSMARGG
GQDSSKIDEGLALGRRMVEEQLGD
Download sequence
Identical sequences D5E9Q1
gi|294495054|ref|YP_003541547.1| WP_013036845.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]