SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495095|ref|YP_003541588.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495095|ref|YP_003541588.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.1e-49
Family ROO N-terminal domain-like 0.0000101
Further Details:      
 
Domain Number 2 Region: 247-391
Classification Level Classification E-value
Superfamily Flavoproteins 4.51e-28
Family Flavodoxin-related 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495095|ref|YP_003541588.1|
Sequence length 395
Comment beta-lactamase [Methanohalophilus mahii DSM 5219]
Sequence
MNTYFVPEISDNVYWVGAKDWDRRMFDALIPLPQGTSYNAYLVKGDAKTALIDSVNPGFE
KELEKKISQVHDIESIDYVIMNHAEPDHSHSIPRIMEKAPEAMLVTTEKGAKMAETYYGV
FQEQIMVVKEGDTLDLGNRTLRFISAPWLHWPETMFTFLEENRVLFPCDFFGAHTAFGMY
DEDVEDLMSLAKKYFGEIMMPFRKMGKKGLEKAQGLSPAMIAPSHGPIYRNPEKIFDAYS
DWTSGKTKEKATIVYVSMWQSTQDMIMQMVEILQSEGIDVCLYNLENADIGDIAMDLVDS
RAIVLGTPTVLGGMHPLALHAANLVKILRPPLKYGAALSSYGWGGGALSQVQDVLGSTKI
ELVGALGVKGPSTEEDTNKIVDLGRELAEKIKDNE
Download sequence
Identical sequences D5E9U2
gi|294495095|ref|YP_003541588.1| WP_013036886.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]