SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495279|ref|YP_003541772.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294495279|ref|YP_003541772.1|
Domain Number - Region: 38-86
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.0837
Family MazG-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495279|ref|YP_003541772.1|
Sequence length 103
Comment hypothetical protein Mmah_0602 [Methanohalophilus mahii DSM 5219]
Sequence
MTRINKVIRDKIPEIIRSSGRECTLKSLDDETFLPELEKKLHEEIDEYIDSQDVEELIDI
LEVVYRIAQLRGYSKAELERIRMQKQVNNGAFMRNLYLFETSG
Download sequence
Identical sequences D5EAC6
gi|294495279|ref|YP_003541772.1| WP_013037070.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]