SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495300|ref|YP_003541793.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495300|ref|YP_003541793.1|
Domain Number 1 Region: 71-271
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.85e-54
Family Biotin holoenzyme synthetase 0.000027
Further Details:      
 
Domain Number 2 Region: 8-60
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000581
Family Biotin repressor-like 0.012
Further Details:      
 
Domain Number 3 Region: 277-320
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.0000105
Family Biotin repressor (BirA) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495300|ref|YP_003541793.1|
Sequence length 322
Comment biotin/acetyl-CoA-carboxylase ligase [Methanohalophilus mahii DSM 5219]
Sequence
MENKKIELIRLLSQADGKPISGEQIGRKLEISRTMVWKYIQSLQSQGYSIISSPGKGYIL
NSVPDFLLPELVQAGLETDILGKDIRHFMELESTNDYAKTIAKDTTEGTVVVAEVQKKGR
GRRGFDWVSPHGGVWISIVLKPSIVSADASRLTLVGGLAVVDSLKSIGLTPSLKWPNDVL
VNGKKICGILTEMEAEIDRVEYIVLGMGINLNFNTEMLPEEIRDGSTTISDELGTYVDRL
EFVRSLLYNLEQYYVHFKTQPFEELMERWIDSSDTIGRKVRIVTPSKMVDGRAIGISPSG
GLLLQKNNGSTEEILSGRCIYI
Download sequence
Identical sequences D5EAE7
WP_013037091.1.50250 gi|294495300|ref|YP_003541793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]