SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495367|ref|YP_003541860.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495367|ref|YP_003541860.1|
Domain Number 1 Region: 2-221,263-364,422-480
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.47e-118
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000472
Further Details:      
 
Domain Number 2 Region: 464-580
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-34
Family Anticodon-binding domain of Class II aaRS 0.0000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294495367|ref|YP_003541860.1|
Sequence length 585
Comment glycyl-tRNA synthetase [Methanohalophilus mahii DSM 5219]
Sequence
MDKYEQVIELAKRRGFLWNSFELYGGTAGFYDYGPLGSTLKRRIENIWRQFYVVREGFME
IETPTIGIEDIFVASGHVGGFSDPLCECEQCKEAFRADHLIEDYVAVADALSNEEVDDII
SKYDICCPECEGKLGKAREFNLMFETSIGPGNGRPGYLRPETAQGIFIDFQRLARYYREK
LPFGVTQIGKSYRNEISPRQGVIRLREFTQAEAEIFIHPQEKKHPEIAAVENDLIILYSD
KAQERGELEEMTIREAIDKKIIAHEFLAYHIALTNRFLKRIGISPDKLRFRQHKKDEMAH
YAIDCWDGEIKTTRFGWIETVGIADRTDYDLNAHTKMSKDDLAVYIEYDEPKMVKKFAVK
PDMGKLGPLFRKKAKDVAETLKQLGPEELEKDGDINIVVNGEEVSVPKDVVSAEEVEEKI
SGETVVPHVIEPSYGIDRIFYTLLEHAYETEMAPTAEEEKEEERTLLKFKSEIAPIQVAV
LPLMKNSDELVSKGRQIVSNLKDMGLMVAYDDSGTIGRRYRRNDEIGTPYSITIDYETLE
DNTVTIRERDTMKQVRTPVSDLEGNLNKLIRGKMELEEAGRPLSL
Download sequence
Identical sequences D5EAL4
WP_013037158.1.50250 gi|294495367|ref|YP_003541860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]