SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495524|ref|YP_003542017.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495524|ref|YP_003542017.1|
Domain Number 1 Region: 122-438
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.8e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000229
Further Details:      
 
Domain Number 2 Region: 6-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.07e-24
Family Anticodon-binding domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495524|ref|YP_003542017.1|
Sequence length 443
Comment aspartyl-tRNA synthetase [Methanohalophilus mahii DSM 5219]
Sequence
MSLKNLRTHYTTQIDPGKIGDDKVALAGWVHEVRDLGGICFVVLRDRQGRAQVTLVKKKI
DRELFNFARKLIRESVISVRGSIKPEEKAPNGYELIPDEIELLNEADSPLPLDTTGKVDA
ELDTRLDSRFIDLRRSRTNAIFRIRHEVLHAVRNYLANDGFLETSSPKVVATATEGGTAL
FPITYFDREAFLNQSPQLFKQILMSGGMDRVFEIGPIFRAEEHDTRRHLNEATSIDIEAS
FVDHFDVMEILENMVEYVYNQVIENVPDALEVLGIELKVPKTPFLKLTYQEAIDIVNSHG
EEELKWGDDLSTLSEHTIGEHVFQETGEEHYFIIDWPTEIKPFYAMPYEEKPEFSKSFDM
MHRTMELSSGAQRIHVPEMLKNRIADQGLDPEGFDFYLRAFSYGMPPHSGWGLGCERFVM
TMLGVENIRDVVLFPRDRRRLSP
Download sequence
Identical sequences D5EB21
WP_013037315.1.50250 gi|294495524|ref|YP_003542017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]