SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495529|ref|YP_003542022.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495529|ref|YP_003542022.1|
Domain Number 1 Region: 22-272
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.21e-62
Family PdxS-like 0.0000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495529|ref|YP_003542022.1|
Sequence length 298
Comment pyridoxal phosphate synthase yaaD subunit [Methanohalophilus mahii DSM 5219]
Sequence
MELENLRHGTELIKRGFARMQKGGVIMDVTNPEQARIAEEAGAVAVMALQAVPADIRKAG
GVARMADPEIVAQIIDTVTIPVMAKARIGHFVEAEILESLGADMVDESEVLTPADEMYHI
DKTGFTVPFVCGARNLGEALRRINEGAAMIRTKGEAGTGDVREAVRHMKKIMGEVRELAG
KDKEELIKVARDIEAPIELVLESADLQRLPVVNFAAGGVATPADAALMMRLGADGVFVGS
GIFKAENPEMMAKAVVEAVNNYDNPEKLAEISRGIGSGMKGMSADTIPPEEALQTRGW
Download sequence
Identical sequences A0A1L3Q4G4 D5EB26
gi|294495529|ref|YP_003542022.1| WP_013037320.1.50250 WP_013037320.1.51233 WP_013037320.1.52505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]