SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495553|ref|YP_003542046.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495553|ref|YP_003542046.1|
Domain Number 1 Region: 15-287
Classification Level Classification E-value
Superfamily MetI-like 4.02e-40
Family MetI-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495553|ref|YP_003542046.1|
Sequence length 297
Comment phosphate ABC transporter membrane protein 1, PhoT family [Methanohalophilus mahii DSM 5219]
Sequence
MFHRRLKEKGIEIGLFLAAATTVVVLLFICIFLFRDGYLLFETSSFTGFITGSSWYTAST
PPRFGILPLLSGSLLVTAGAIAIAVPMGVAAAIYISELASPKMADLLKPFIEILAGIPSV
VYGFFGLVVLVPIIKDIFDLPTGQTALTGSIMLAMMALPTIISISEDAINAVPQALKEGS
LALGSTQWQTIYKVTLPAALSGISAAVILGVGRAIGETMTVLMVTGNMAIIPGFPEGFID
PVRTMTATIALEMGEVPKGSPHFHALFAVGSVLFVTTFIINMLADRIKRKYKLREGL
Download sequence
Identical sequences D5EB50
WP_013037344.1.50250 gi|294495553|ref|YP_003542046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]