SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495583|ref|YP_003542076.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495583|ref|YP_003542076.1|
Domain Number 1 Region: 222-362
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 5.1e-29
Family Cobalamin (vitamin B12)-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 14-130
Classification Level Classification E-value
Superfamily Globin-like 0.0000495
Family Phycocyanin-like phycobilisome proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495583|ref|YP_003542076.1|
Sequence length 363
Comment cobalamin B12-binding domain protein [Methanohalophilus mahii DSM 5219]
Sequence
MPQNNNIPLKCTAIGQFLYNNCSMLAEKTVEIQYSRQSELYSKYGEKGKKFSLQDCKYHI
FYLGESICLCSKTLFLDYMQWVKVLMSNLGIHEKYLITNIEIIKEVISECASQGQITKED
ISVVFEYLDAGLMAFKNEDTFSPSYIDKSTEYGELAGQYLDLLTEGQKKEASYLIFEILE
EGASIKDIYLNIFQPSQYEVGRLWQTNKISVAKEHYITASTQNIMSQLYPRIMTQQKNGH
TVIATCIGSELHELGIRMVADFFEMDGWDSYYLGANTPASSIIQMVKDTNAQLVIISATL
SINVHKLKNLIEDLRRSKDLDDTKIMVGGHPFNIDPDLWEKVGADLSAPDAQQSMEVANE
LFE
Download sequence
Identical sequences D5EB80
gi|294495583|ref|YP_003542076.1| WP_013037374.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]