SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495621|ref|YP_003542114.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294495621|ref|YP_003542114.1|
Domain Number - Region: 166-269
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.051
Family HPr kinase/phoshatase HprK N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294495621|ref|YP_003542114.1|
Sequence length 282
Comment methanogenesis marker protein 8 [Methanohalophilus mahii DSM 5219]
Sequence
MPHVMELLGKTRIVVRDGKVIEVGEPAVKWCPLFDKLRGIKEITPEAARENMEFRIKDFG
LFTSERKLEQDVFVGFGASEVMMTGLNRDMLDTTVTVCDGAGTVITNNPKLVQGMGARIS
GLIETEPIDAVINGIAEKGGIVLDPATAEINPEGGVLKAAKLGYRRIAVTVVHSENAARL
RQLEAEDDLDLLIIAAHTTGLGKEEAMELFQHVDITTGCASRQIRELIKPLAQVGTAVPL
FALTQKGKEMLLERAKEVESPVLINTMSLPVLPEHKQPRELV
Download sequence
Identical sequences D5EBB8
WP_013037412.1.50250 gi|294495621|ref|YP_003542114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]