SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495685|ref|YP_003542178.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495685|ref|YP_003542178.1|
Domain Number 1 Region: 136-521
Classification Level Classification E-value
Superfamily Subtilisin-like 7.59e-66
Family Subtilases 0.000000188
Further Details:      
 
Domain Number 2 Region: 504-612
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-26
Family Proprotein convertase P-domain 0.00047
Further Details:      
 
Domain Number 3 Region: 616-690
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000503
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294495685|ref|YP_003542178.1|
Sequence length 1233
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Methanohalophilus mahii DSM 5219]
Sequence
MQNQSDWILLKHSHINTDEAGSSIQTQSVVPFEKGYYIVQFTGIIQPEWQEEIQNISGIY
GYIPENAYVLYLNDTKANHIKALPYFKWMGKIKPEYKIEPEIRKTKGNITLNIKLYKNDR
ALNTTDYIEKMGGIVLSGNSRLLQVHINSSLIDSIAALENVEWIEKHHKPVILNNNASRI
MNVTTIHQNYSLTGSGQIIGIADTGVDTGYNNESMHDDIEGRIINISSWGDEDASDTHGH
GTHVAGSALGNGSLSGGKYSGTAPAANLVFQAIGDEDGDLPGVSTSEDLFELLSFAYAKN
ARIHSNSWGNSNNSYTTYSEVADEFIWNHTDMLVLFAAGNYGENGSYTVGSPATAKNILT
IGATENLRPEKDSLGDNPDEIASFSSRGPTADGRIKPDLVAPGTWIISIRSSKTTNESIF
WEPLNDSYAYMGGTSMATPLAAGTSALVRQYYMENLSISPSAALIKATLINGADDLGYNR
TTQGWGRINLTASLYPPAPAEVAYYDNISLTTGETWQTKQYVKSNQTPFKATLVWTDHPG
STKAEKVLVNDLDFTIMVPNGSILYGNGGEGPDRLNNIEQVLLASPDTGNYTLCVNGSNI
PEGPQPFAFVVSADIDVTPPASITDLHASNIGCTWINWTWSNPDDTDFNHTMVYLDGELK
GNVSNEYYNATDLYPNTTYEIAIRTVDVNGNINTTWQNDSATTDEDTLLPVVYSASLDNY
TPGMDETITLNVNATDAESGIGNITAFMDGTSPSIPLDYNTTSGNYTATFYAEYGWHSMN
ISVTDNASNTRWDNSTSYEGKDVTSPVITSVILDNHIPEVGEYIALKVNASDNIDIMDVT
AYNGSMSTTVELTLNDGNYTGNLLANPGLNAVNVSATDTSGNTGWYNDTFYIAGDDEKPV
ISNVSIDSPTPFIGDPVILEVNTSDNIGILNVTAYNGSMSSPIELILDTDGNYTGTLIAN
SGINTVNISATDASGNTAWDNSTIYDGQDKPGDSNNEKGSSGGGGGSATGEEYSNIKFKD
FSIRSVKAEVPTIYNFEEKENPVIDIDLISSKNSGQAKLIIEVLKNTSTLTNEPPIDTVY
INLNIWAGSSGFENHIRNSSVTFKVEKEWITQENIDIENIRLEVFEDGQWISLPTEYIDE
VGNYLHFKTATDKYLNSPFVIAGSEMEQKSNAENDNVIAETNNLNTQKTDTNESVNNVSG
EAEKNVLGSEKVMDKMLPAWILIIAFIVRRKLE
Download sequence
Identical sequences D5EBI2
gi|294495685|ref|YP_003542178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]