SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495737|ref|YP_003542230.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495737|ref|YP_003542230.1|
Domain Number 1 Region: 208-476
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-71
Family Extended AAA-ATPase domain 0.000000119
Further Details:      
 
Domain Number 2 Region: 481-745
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-70
Family Extended AAA-ATPase domain 0.000000445
Further Details:      
 
Domain Number 3 Region: 10-96
Classification Level Classification E-value
Superfamily ADC-like 9.94e-24
Family Cdc48 N-terminal domain-like 0.0022
Further Details:      
 
Domain Number 4 Region: 98-201
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.000000000000556
Family Cdc48 domain 2-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294495737|ref|YP_003542230.1|
Sequence length 761
Comment ATPase AAA [Methanohalophilus mahii DSM 5219]
Sequence
MVVIIAGNENVSVKLKVAEAIQKDVGKGVVRIDESFRNKLGLQGLDVVEVIGSRNTPALA
ARAYPSDEGLDIIRMDGLVRTNANTGIGDYIEVRKAQWKEAKNVKLSPVSKGVKIAASGE
MLRSVLQNRPVSKGDFISTTSSSQQKALGGGLMFEDFFQDIFGSSFGLGEIKLQVISTSP
HGIVKITDRTEIELLPEAVELPPEHAIPTVMYEDLGGIKPAIGKIREMIELPLKHPELFD
RLGIDAPKGVLLQGPPGTGKTMLARAVANESDAYFISINGPEIMSKFYGESEQHLRQLFE
DAEANAPSIIFLDEIDSIAPKRAEVTGEVERRVVSQLLSLMDGLKERKNVIVIGATNRPG
ALDMALRRPGRFDREIELRVPDTDGRLEILQIHTRGMPVTEDVNLEELADITYGFVGADI
AALCREAAMSSLRRILPEIDLKAEQIPREIIDKLQVTREDFNEALKTVQPSAMREILIEV
PNVTWEDVGGLEEVKSLLKEAVEWPLKYPDSFRRIGVDAPKGVLLYGPPGTGKTMLAKAI
AHESNVNFISAKGSDLLSKWYGESEKRIAEVFVRARQVAPSIVFLDELDALAPLRGAAAG
EPQVTERIVNQLLSEMDGLEELRGVVVIGATNRPDIIDPALLRPGRFDELIMVPVPDSQT
RNKILQVHTRNMMLAGDVDFSELVKQTDSFTGADIAAVCKKAGRFALREDINASKVQMQH
FQKALEETGPSVTPETTRYYENIRGELRTKQAKGIEGVGYA
Download sequence
Identical sequences D5EBN4
WP_013037528.1.50250 gi|294495737|ref|YP_003542230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]