SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495750|ref|YP_003542243.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495750|ref|YP_003542243.1|
Domain Number 1 Region: 338-567
Classification Level Classification E-value
Superfamily PHP domain-like 1.05e-53
Family PHP domain 0.00048
Further Details:      
 
Domain Number 2 Region: 157-317
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.87e-42
Family DNA polymerase beta-like 0.003
Further Details:      
 
Domain Number 3 Region: 1-86
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000000000000196
Family DNA polymerase beta, N-terminal domain-like 0.0016
Further Details:      
 
Domain Number 4 Region: 94-144
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000967
Family DNA helicase RuvA subunit, middle domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495750|ref|YP_003542243.1|
Sequence length 570
Comment PHP domain protein [Methanohalophilus mahii DSM 5219]
Sequence
MINRDIAKLLYEIADIFEYKEVEWKPRAYRKAARKIGDMREDISGLYSKKGREGLENIPG
VGSRIADHIVEYIEAGSVREFEKIRKETPRGASNIIKIRGLGPKKAKKLMDELDIQSIPD
LKEAINNQEIRKLEGFGKKTEENLDKAISQYEKSHERMLLPKATDLAEEIISYMEENTTL
KKIDYAGSLRRMKETIGDIDILVVASDPEEVMDAFVNFENVDEVESRGKTRSTIILQNGG
HIDLRVVPESSYGAALQYFTGSKDHNIELRNLALSKGYKLSEYGLFKEDSKKKLEGKKED
RIYGKLGLSFIPPELRENRGELECAKNTLPSLVELEDIRGDLHVHTSYSDGTDSLNSMIA
QADKLGYEYIGITDHSRSRKIAGGLGTDKVKEQWKEIDGLRDDFDIEILKGIEVDILPDG
SLDCPDDILEEMDIVVGSIHSGYKSPKKKMTERIITALQNEFLHVLGHPTSRKIGIREAY
EVDLDKIFETAAENGKLLEINSQPERLDLNDNLILQAKEYDLKFCISSDSHSSAQLDFMK
YGVGQARRGWLTKDDVANTYSLKELKRLID
Download sequence
Identical sequences D5EBP7
WP_013037541.1.50250 gi|294495750|ref|YP_003542243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]