SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294495799|ref|YP_003542292.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495799|ref|YP_003542292.1|
Domain Number 1 Region: 126-241
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.1e-27
Family MJ1460-like 0.011
Further Details:      
 
Domain Number 2 Region: 17-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000024
Family PF1790-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495799|ref|YP_003542292.1|
Sequence length 244
Comment ArsR family transcriptional regulator [Methanohalophilus mahii DSM 5219]
Sequence
MNATNRTALFATNNGFIAINGAVKLQIMDLLDKRPCSFDEIVQNTGKAKSTVSVHLNDLK
KANLLRESVDAVDRRKKNYNLSSKYVACSQKPLDTHYYQSLENFSSTFSGETDFFQNVFC
AFKAGFEAQGINHNPIVKHIGSDIGTQIANTFEQGDFFDSLEEVRSFWECYKLGKVQIED
TDPLTIEVKDCFECMSMPVIGHPICSFDEGMLEGILYKITGERHSIKEIECYATGDNHCL
FIKV
Download sequence
Identical sequences D5EBU6
gi|294495799|ref|YP_003542292.1| WP_013037590.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]